
Pair of comfortable hiking boots on white background. Camping tourism
Stock Photo ID: 16215
Large 4987 × 4480 px, JPG 175.93 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Pair of comfortable hiking boots on white background. Camping tourism”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4987 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Aug 2021
You may use our image “Pair of comfortable hiking boots on white background. Camping tourism” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
activityadventurebackgroundbackpackingbeautifulbootsbrowncampercampingcasualcolorcomfortcomfortablecomfyconceptdesignelegantexpeditionexplorefashionfootgearfootweargearhikerhikinghobbyisolatedjourneylifestylemodernnewnobodyobjectpackpairshoelacesshoessizestylestylishtourismtraveltrendtrendytripwanderlustwardrobewarmwearwhite
Africa Images: the ultimate destination for royalty-free stock photos
Africa Images produces high-quality stock imagery designed to enhance your marketing and advertising endeavors. A detailed process is followed by our expert team before any image is posted on our website, including researching trending and popular materials. Our team of professionals arranges everything you can see in our high-resolution photos, including furniture, food, and technology. With a varied collection covering everything from Christmas to pregnancy and transportation, as well as a range of sizes and resolutions available, there’s a suitable image for all requirements. We offer cost-effective and royalty-free stock photography that will make your brand stand out from the crowd.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From payment to download, experience a seamless online journey
As a leading online supplier of stock images, users can experience great customer satisfaction from start to finish when it comes to downloading their chosen pictures. The process of finding exactly what you are looking for and comparing the different license plans available results in an enhanced purchase interaction. You can choose from a Standard or Extended on-demand pack depending on how you plan to use your new downloads. Both options also provide savings when purchasing in bulk. So not only is this more cost-effective but it means you can bank these additional photos for future use in your work initiatives.








